Products Categories
    Product Certification&
    Enterprise Certification

  • Mr.xiang
    Tel: +87-17342063383

  • Mobile:
  • Tel:+87-17342063383
  • Fax:
  • URL:http://www.research-peptide.com
  • Province/state:Anhui
  • City:Hefei
  • Street:Room 0196, Four-storey Creative Space, EC Building, Baohe Garden Commercial Building, Baohe District.
  • MaxCard:
Home > Products >  TKFTLSLDVPTNEREKKRKEAKAKNLRAQAAANAHLMAQI-NH2

TKFTLSLDVPTNEREKKRKEAKAKNLRAQAAANAHLMAQI-NH2

  • Min.Order: 0
  • Payment Terms:
  • Product Details

Keywords

  • peptide
  • polypeptide

Quick Details

  • ProName: TKFTLSLDVPTNEREKKRKEAKAKNLRAQAAANAHLMA...
  • Appearance: White powder solid
  • Application: Applied to various scientific research
  • PackAge: 5mg, 10mg 100mg, 1gram
  • Purity: HPLC>98%
  • Storage: Negative 20 degrees Celsius
  • LimitNum: 0

Superiority

High purity, high success rate, short cycle and moderate price

Details

1. Common short peptide long peptide



2. Fluorescent/dye labeled biotin, FITC, FAM, dansyl, MCA, pNA, AMC, TAMRA, CY



3. Chelator Peptides NOTA, DOTA Modified Peptides



4, glycopeptide.



5. Polypeptides Modified by Numerous Carboxyl Compounds and Amino Compounds



6. Introduction of azide, alkynyl and alkenyl polypeptides and click chemical applications



7. Polypeptides Containing Small and Macromolecular PEG



8. Cyclic peptides (such as amide, disulfide bond, thioester, thioether bond, urea group)



9. Isotope labeled peptide



10. Phosphorylated and Sulfonated Peptides



11, Polyantigen Peptide



12, KLH and BSA protein carrier polypeptide



13, R8S5 Stapler Peptide



14, quenched fluorescent peptide Abz/Tyr(3-NO2) and EDANS/Dansy



15, methylated peptide



16, MAPs Polyantigen Peptide



17, aldehyde peptide



18, CMK, AMC, pNA and other inhibitor polypeptides



19, Peptide Nucleic Acid



20, cyclic dipeptide

Other products of this supplier

lookchemhot product CAS New CAS Cas Database Article Data Chemical Catalog