- Product Details
Keywords
- peptide
- polypeptide
Quick Details
- ProName: Y(aib)QGTFTSDYSIYLDKQAAQDFVNWLLAG-NH2
- Appearance: White powder solid
- Application: Applied to various scientific research
- PackAge: 5mg, 10mg 100mg, 1gram
- Purity: HPLC>98%
- Storage: Negative 20 degrees Celsius
- LimitNum: 0
Superiority
High purity, high success rate, short cycle and moderate price
Details
2. Fluorescent/dye labeled biotin, FITC, FAM, dansyl, MCA, pNA, AMC, TAMRA, CY
3. Chelator Peptides NOTA, DOTA Modified Peptides
4, glycopeptide.
5. Polypeptides Modified by Numerous Carboxyl Compounds and Amino Compounds
6. Introduction of azide, alkynyl and alkenyl polypeptides and click chemical applications
7. Polypeptides Containing Small and Macromolecular PEG
8. Cyclic peptides (such as amide, disulfide bond, thioester, thioether bond, urea group)
9. Isotope labeled peptide
10. Phosphorylated and Sulfonated Peptides
11, Polyantigen Peptide
12, KLH and BSA protein carrier polypeptide
13, R8S5 Stapler Peptide
14, quenched fluorescent peptide Abz/Tyr(3-NO2) and EDANS/Dansy
15, methylated peptide
16, MAPs Polyantigen Peptide
17, aldehyde peptide
18, CMK, AMC, pNA and other inhibitor polypeptides
19, Peptide Nucleic Acid
20, cyclic dipeptide